PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Csa11g007550.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Camelina
Family B3
Protein Properties Length: 382aa    MW: 43503.2 Da    PI: 4.6057
Description B3 family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Csa11g007550.1genomeCSGPView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1B348.71.4e-157831999
                    -HHH.HTT---..--SEEEEEETTS-EEEEEE..EEETTEEEE-TTHHHHHHHHT--TT-EEEEEE-SSSEE..EEEEE-S CS
              B3 19 pkkfaeehggkkeesktltledesgrsWevkliyrkksgryvltkGWkeFvkangLkegDfvvFkldgrsefelvvkvfrk 99
                    p +f++++ +   ++ +++l+ + grsW+v    + +++++ +++GW +Fv++n +++gDf++F ++g++ f   v++fr+
  Csa11g007550.1  7 PPRFFKAFVSHYSSDSMVILQGPGGRSWNVAT--NIRGNEVHFAQGWPKFVEDNTINDGDFLTFVYNGNHIF--EVSIFRS 83
                    66666666333335569***************..99999999*************************99999..9999986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5086315.016184IPR003340B3 DNA binding domain
Gene3DG3DSA:2.40.330.101.5E-17586IPR015300DNA-binding pseudobarrel domain
SuperFamilySSF1019361.69E-18586IPR015300DNA-binding pseudobarrel domain
CDDcd100178.17E-12682No hitNo description
PfamPF023621.3E-12783IPR003340B3 DNA binding domain
SMARTSM010195.6E-111084IPR003340B3 DNA binding domain
SuperFamilySSF1019366.87E-5282367IPR015300DNA-binding pseudobarrel domain
Gene3DG3DSA:2.40.330.107.7E-4299367IPR015300DNA-binding pseudobarrel domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 382 aa     Download sequence    Send to blast
MADFQFPPRF FKAFVSHYSS DSMVILQGPG GRSWNVATNI RGNEVHFAQG WPKFVEDNTI  60
NDGDFLTFVY NGNHIFEVSI FRSDGCKETS EFIEVEDDEG NSVCSLSSDD TNTRSKPEME  120
NPIPKAETKS KVEVVEDSDE DEDSVYSESS EDTETESDSG SEFKIGKTTP KRQNKGKKKD  180
QEAVPVEEES SEEDGEGDGD SDSDYVEAFG QLDVEDKSNS EDSSYAPEEE DTAASTTCVK  240
AKVPNLKRKE AAKKRKKEML LSLEIFTVEP EIKNPETYLD DPKNIHFETN VKNRLYELLV  300
HAQLVKDYCL RFGDYVDYID RFGKLRVKTA KWKDQRVCIK RWMRICKRNG LTKEDRVLCE  360
LLRRGSFVYA IKLHVIRGKD L*
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1252256KKRKK
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010432421.10.0PREDICTED: B3 domain-containing protein At4g34400-like
SwissprotQ9SZ051e-146Y3440_ARATH; B3 domain-containing protein At4g34400
TrEMBLR0F8941e-178R0F894_9BRAS; Uncharacterized protein (Fragment)
STRINGscaffold_700694.11e-157(Arabidopsis lyrata)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM65551641
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G34400.11e-135B3 family protein